GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000824-TA|BGIBMGA000824-PA|undefined
         (211 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_22361| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  

>SB_22361| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 15/52 (28%), Positives = 28/52 (53%)

Query: 134 APLDSRPSARRASHIIETRIMMRRSRNLTRWSTLEPEAALQTLIDPPISLKT 185
           A +  RPS RR  ++++ R+    +  LT  + +E  A  +TL    +S++T
Sbjct: 22  ALVPKRPSTRRRRYLMKIRMQEWENVKLTAATRMESAALPETLPTSDLSIRT 73


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.321    0.136    0.419 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,973,743
Number of Sequences: 59808
Number of extensions: 196487
Number of successful extensions: 242
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 241
Number of HSP's gapped (non-prelim): 1
length of query: 211
length of database: 16,821,457
effective HSP length: 79
effective length of query: 132
effective length of database: 12,096,625
effective search space: 1596754500
effective search space used: 1596754500
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 58 (27.5 bits)