BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000822-TA|BGIBMGA000822-PA|undefined (78 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 1.5 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 1.5 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 19 8.1 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.0 bits (42), Expect = 1.5 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 34 QVSCAVDNQGNVILDPTH 51 Q C ++G+ I+D TH Sbjct: 71 QYVCKAKDEGSCIIDKTH 88 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.0 bits (42), Expect = 1.5 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 34 QVSCAVDNQGNVILDPTH 51 Q C ++G+ I+D TH Sbjct: 71 QYVCKAKDEGSCIIDKTH 88 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 18.6 bits (36), Expect = 8.1 Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 42 QGNVILDPTHAQLQTSTATMTFVFDSRDKSLITCK 76 +G+V + TH Q Q T +T S TC+ Sbjct: 467 RGSVFVRFTHLQHQPFTYKITVNNQSNGNRKGTCR 501 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.131 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,786 Number of Sequences: 317 Number of extensions: 429 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 78 length of database: 114,650 effective HSP length: 46 effective length of query: 32 effective length of database: 100,068 effective search space: 3202176 effective search space used: 3202176 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.6 bits) S2: 36 (18.6 bits)
- SilkBase 1999-2023 -