GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000821-TA|BGIBMGA000821-PA|IPR006802|Radial
spokehead-like protein
         (257 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF117201-1|ABL67438.1|  481|Anopheles gambiae serpin 17 protein.       25   2.8  
DQ004399-1|AAY21238.1|  847|Anopheles gambiae lysozyme c-6 protein.    24   5.0  

>EF117201-1|ABL67438.1|  481|Anopheles gambiae serpin 17 protein.
          Length = 481

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 190 LKFDPPNYGPAQLPRPQDEYPIGPEVMEMA 219
           L+F  PN    Q PRPQ   P  P  M+ A
Sbjct: 83  LRFPAPNQNEQQQPRPQP--PKTPGAMQFA 110


>DQ004399-1|AAY21238.1|  847|Anopheles gambiae lysozyme c-6 protein.
          Length = 847

 Score = 23.8 bits (49), Expect = 5.0
 Identities = 6/14 (42%), Positives = 11/14 (78%), Gaps = 1/14 (7%)

Query: 68  VFWVCNHPGEQWIC 81
           ++W C+ PG+ W+C
Sbjct: 714 IYW-CSPPGKGWVC 726


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.133    0.432 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,459
Number of Sequences: 2123
Number of extensions: 7134
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 3
length of query: 257
length of database: 516,269
effective HSP length: 63
effective length of query: 194
effective length of database: 382,520
effective search space: 74208880
effective search space used: 74208880
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)