BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000820-TA|BGIBMGA000820-PA|IPR006802|Radial spokehead-like protein (177 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0022 - 40543912-40544004,40545060-40545229,40545850-405459... 30 0.92 10_08_0842 - 20954712-20957738 27 8.6 >01_07_0022 - 40543912-40544004,40545060-40545229,40545850-40545971, 40549272-40550909,40553212-40553720 Length = 843 Score = 30.3 bits (65), Expect = 0.92 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 25 PDVVDHFEQYSWQVKQEKFRPNFDLLNDVY 54 P+V +HFE +W V K RP D+L D+Y Sbjct: 223 PEVRNHFEIRTWTVLPPKCRP-ADVLRDIY 251 >10_08_0842 - 20954712-20957738 Length = 1008 Score = 27.1 bits (57), Expect = 8.6 Identities = 8/28 (28%), Positives = 21/28 (75%) Query: 12 LVDVVQKILSQKPPDVVDHFEQYSWQVK 39 +++ V++++S+ PPD+V +F++ Q + Sbjct: 454 ILNSVKRLISRNPPDIVLYFDRLDMQTR 481 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.323 0.139 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,361,013 Number of Sequences: 37544 Number of extensions: 140680 Number of successful extensions: 290 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 289 Number of HSP's gapped (non-prelim): 2 length of query: 177 length of database: 14,793,348 effective HSP length: 77 effective length of query: 100 effective length of database: 11,902,460 effective search space: 1190246000 effective search space used: 1190246000 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -