BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000820-TA|BGIBMGA000820-PA|IPR006802|Radial spokehead-like protein (177 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 24 2.3 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 24 3.0 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 7.0 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 7.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 22 9.3 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 24.2 bits (50), Expect = 2.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Query: 10 DHLVDVVQKILSQKPPDVVDH 30 DHL D +Q++ S+ PP+ + + Sbjct: 208 DHLFDHMQEVWSKIPPETIQN 228 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.8 bits (49), Expect = 3.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 36 WQVKQEKFRPNFDLLNDVYLSPPQLAVVRRIEEMFRLVK 74 WQVK NF + ND+ + A V+ +E + VK Sbjct: 316 WQVKSGTIFDNFMITNDLEEAKKVAASVKETQEGEKKVK 354 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 22.6 bits (46), Expect = 7.0 Identities = 11/48 (22%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 5 PSSRYDHLVDVVQKILSQKPPDVVDHFEQYSWQVKQEKFRPNFDLLND 52 PS+ D L+ + I SQK + +++ + + + + +P D + D Sbjct: 33 PSNEVDLLIQIGNGIFSQKGTKFDERYDKLAKDLYKSELKP-LDFVGD 79 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 22.6 bits (46), Expect = 7.0 Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 9 YDHLVDVVQKILSQKPPDVVDHFEQ 33 +D ++ ++ + PPD V+ FE+ Sbjct: 154 FDKFEEIQVRVSGENPPDHVESFER 178 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.2 bits (45), Expect = 9.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 13 VDVVQKILSQKPPDVVDH 30 VDV+Q ++ K P+V+ H Sbjct: 945 VDVIQVVVPVKAPNVLPH 962 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.139 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,939 Number of Sequences: 2123 Number of extensions: 5077 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 5 length of query: 177 length of database: 516,269 effective HSP length: 60 effective length of query: 117 effective length of database: 388,889 effective search space: 45500013 effective search space used: 45500013 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -