BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000819-TA|BGIBMGA000819-PA|IPR001509|NAD-dependent epimerase/dehydratase (212 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.6 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 7.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 65 GTDAVVITLGTRNDLAPTSDLSEGTKN 91 G V++TL T + AP D T+N Sbjct: 5 GLFCVLVTLATARNKAPLLDDGTRTRN 31 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 9.6 Identities = 11/34 (32%), Positives = 14/34 (41%) Query: 137 LKDSGLNWIAAFPPHFTDDPSREMIIEVNPEKTP 170 L D+G PP + PS E + E E P Sbjct: 1764 LADAGTGQQETIPPIDEEPPSVEAVEEEREEAPP 1797 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,481 Number of Sequences: 317 Number of extensions: 1960 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 212 length of database: 114,650 effective HSP length: 54 effective length of query: 158 effective length of database: 97,532 effective search space: 15410056 effective search space used: 15410056 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -