BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000818-TA|BGIBMGA000818-PA|IPR000182|GCN5-related N-acetyltransferase (201 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 >SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 47.6 bits (108), Expect = 7e-06 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 5/81 (6%) Query: 4 ENLKVLPLHKHPEYLKACCEMINEEWPRSETARMMSLQASCNELPTSLILV-----ANTK 58 E L LH++ + + +++ EWPRS+ AR SL S + P +++LV ++ Sbjct: 6 EETDFLKLHENVTFAEEVVNLLSSEWPRSKAARYHSLNLSNDNFPCAMVLVRRDPQCHST 65 Query: 59 SLLGHCKLTAIPSIPESCFVE 79 ++GHC + + ++ F+E Sbjct: 66 EVVGHCVFSKVHGSEDALFIE 86 >SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/38 (39%), Positives = 17/38 (44%) Query: 135 ISIYGVRLPSHSYSSAVSIKLDNPVAINPITQTVPGAF 172 I + +P Y S I L V INPIT VP F Sbjct: 196 IMVLNTLIPISLYISVGEISLGKGVWINPITNFVPSRF 233 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,173,659 Number of Sequences: 59808 Number of extensions: 220940 Number of successful extensions: 524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 522 Number of HSP's gapped (non-prelim): 2 length of query: 201 length of database: 16,821,457 effective HSP length: 79 effective length of query: 122 effective length of database: 12,096,625 effective search space: 1475788250 effective search space used: 1475788250 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -