BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000814-TA|BGIBMGA000814-PA|IPR011011|Zinc finger, FYVE/PHD-type, IPR013136|WSTF/Acf1/Cbp146, IPR004022|DDT, IPR001965|Zinc finger, PHD-type (1015 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 24 4.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 6.0 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 347 EWQKVKDDLELEDHKMIPKGTPIDI 371 +WQK+ +E +D I K P+ I Sbjct: 468 DWQKIAGAVEEDDEDAIEKPAPVKI 492 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.8 bits (49), Expect = 6.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Query: 809 MLRGYDKQADYLTWGPNQMYRDDYHQPNGVLNIPQDL 845 M R YD Q D + + NQ Y D + G+ +DL Sbjct: 403 MARRYDVQTDSILFVNNQPYSRDSYNLAGMGETIEDL 439 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.133 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,309 Number of Sequences: 317 Number of extensions: 8283 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 2 length of query: 1015 length of database: 114,650 effective HSP length: 64 effective length of query: 951 effective length of database: 94,362 effective search space: 89738262 effective search space used: 89738262 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -