BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000813-TA|BGIBMGA000813-PA|IPR002198|Short-chain dehydrogenase/reductase SDR, IPR002347|Glucose/ribitol dehydrogenase (317 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 3.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.9 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 9.0 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 21 9.0 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 21 9.0 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 281 PSQEAQDFELAQWLWRVSEAWTKL 304 P + F L LW+ +AWT L Sbjct: 25 PYYNFEKFSLEHQLWQKIQAWTYL 48 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 3.9 Identities = 13/49 (26%), Positives = 21/49 (42%) Query: 268 CAGDYYVDMKKAEPSQEAQDFELAQWLWRVSEAWTKLDEHKQAIAKDTR 316 C G+ + A + A D A+ R A L +H+ A+A+ R Sbjct: 267 CGGEEEAERAPAPAVRAAGDAAAARGAARADGAGGPLHDHRPALAQQRR 315 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/36 (27%), Positives = 18/36 (50%) Query: 245 FMKKPEIGGQTVVHAALDPKLKDCAGDYYVDMKKAE 280 ++K +GG +V +LD C D Y ++ A+ Sbjct: 401 YVKAKGLGGIAIVDLSLDDFKGTCGRDKYDILRTAK 436 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 168 RIHKQDLNMSENYDASAAYSQS 189 + H Q L S +A AAYS S Sbjct: 17 QFHHQQLFQSATTEAPAAYSSS 38 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 168 RIHKQDLNMSENYDASAAYSQS 189 + H Q L S +A AAYS S Sbjct: 17 QFHHQQLFQSATTEAPAAYSSS 38 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,816 Number of Sequences: 317 Number of extensions: 2335 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 5 length of query: 317 length of database: 114,650 effective HSP length: 57 effective length of query: 260 effective length of database: 96,581 effective search space: 25111060 effective search space used: 25111060 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -