BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000812-TA|BGIBMGA000812-PA|IPR001478|PDZ/DHR/GLGF (657 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 4.5 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 23 7.9 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 138 YSDYNINGQNGETETSIVAAAVSVIGDNPQKI 169 Y +YNING N + + + ++S + + KI Sbjct: 223 YGNYNINGFNFQWKDGLFGLSLSALQTDGYKI 254 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 23.0 bits (47), Expect = 7.9 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Query: 471 RNSIDSGPRPVVNLASDREGFEARKIISGSLNNLTTLVKAQS-DTSINTS 519 R + ++ ++N A D+ G A+K ++ NNL +V + S ++IN S Sbjct: 195 RQTFENQVNRILNDARDKTGGSAKKSLT-EYNNLKAMVVSGSKGSNINIS 243 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.133 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,658 Number of Sequences: 429 Number of extensions: 7541 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 657 length of database: 140,377 effective HSP length: 62 effective length of query: 595 effective length of database: 113,779 effective search space: 67698505 effective search space used: 67698505 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -