BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000811-TA|BGIBMGA000811-PA|undefined (59 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0354 + 2804640-2804703,2804911-2806451 25 5.9 07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733 25 7.7 >01_01_0354 + 2804640-2804703,2804911-2806451 Length = 534 Score = 25.4 bits (53), Expect = 5.9 Identities = 8/27 (29%), Positives = 17/27 (62%) Query: 8 IDDHNHSVKSYTDKAEAVGRVSSVTLL 34 + +NH ++YT+ + +GR+ V L+ Sbjct: 139 LPQYNHGSRAYTEMLDILGRMKKVRLM 165 >07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733 Length = 181 Score = 25.0 bits (52), Expect = 7.7 Identities = 12/41 (29%), Positives = 21/41 (51%) Query: 2 PPTPEAIDDHNHSVKSYTDKAEAVGRVSSVTLLTCPISHVF 42 P P A ++ S T+ +A ++SV + TC + +VF Sbjct: 141 PSPPPAGSAGSNKTSSATNSKKAASLMASVLIPTCALFYVF 181 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.131 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,868,396 Number of Sequences: 37544 Number of extensions: 50299 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 111 Number of HSP's gapped (non-prelim): 2 length of query: 59 length of database: 14,793,348 effective HSP length: 39 effective length of query: 20 effective length of database: 13,329,132 effective search space: 266582640 effective search space used: 266582640 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -