BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000810-TA|BGIBMGA000810-PA|undefined (65 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q80B00 Cluster: MC043L-like protein; n=5; Parapoxvirus|... 32 1.9 UniRef50_Q6AIT0 Cluster: UPF0061 protein DP3021; n=4; Proteobact... 30 7.7 >UniRef50_Q80B00 Cluster: MC043L-like protein; n=5; Parapoxvirus|Rep: MC043L-like protein - Orf virus Length = 797 Score = 32.3 bits (70), Expect = 1.9 Identities = 16/58 (27%), Positives = 27/58 (46%) Query: 7 LGSWALVTHDTLLAITQTYLSLINPVRASSQDVSCSLLKTQTDRFSKIYIFVITPNLS 64 L WA+ D LA + IN + D + L ++ +FS I ++TP+L+ Sbjct: 21 LDIWAIEREDLTLAALMGFTGTINSNFSQRHDYNLHRLASELSKFSSSCILIVTPDLT 78 >UniRef50_Q6AIT0 Cluster: UPF0061 protein DP3021; n=4; Proteobacteria|Rep: UPF0061 protein DP3021 - Desulfotalea psychrophila Length = 482 Score = 30.3 bits (65), Expect = 7.7 Identities = 17/58 (29%), Positives = 30/58 (51%) Query: 8 GSWALVTHDTLLAITQTYLSLINPVRASSQDVSCSLLKTQTDRFSKIYIFVITPNLSL 65 G+ + ++ + + + L LIN R + D LL TDRF+++YI ++ L L Sbjct: 284 GNQSAISQWNMTRLAECLLPLINADRNRAIDQLNPLLIAYTDRFNRVYIKMMGKKLGL 341 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.320 0.129 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,548,889 Number of Sequences: 1657284 Number of extensions: 1526034 Number of successful extensions: 3426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3424 Number of HSP's gapped (non-prelim): 2 length of query: 65 length of database: 575,637,011 effective HSP length: 45 effective length of query: 20 effective length of database: 501,059,231 effective search space: 10021184620 effective search space used: 10021184620 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -