BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000810-TA|BGIBMGA000810-PA|undefined
(65 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07) 25 6.5
>SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07)
Length = 656
Score = 25.4 bits (53), Expect = 6.5
Identities = 14/55 (25%), Positives = 28/55 (50%)
Query: 2 SQEATLGSWALVTHDTLLAITQTYLSLINPVRASSQDVSCSLLKTQTDRFSKIYI 56
++ ATL +A+ L+ Y+ +N ++A++Q + +QT R IY+
Sbjct: 232 NRNATLYVFAIPIALALVVNAIFYILTVNAIKAATQQARMAAENSQTRRHFGIYV 286
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.320 0.129 0.362
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,838,519
Number of Sequences: 59808
Number of extensions: 46110
Number of successful extensions: 87
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 86
Number of HSP's gapped (non-prelim): 1
length of query: 65
length of database: 16,821,457
effective HSP length: 44
effective length of query: 21
effective length of database: 14,189,905
effective search space: 297988005
effective search space used: 297988005
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 52 (25.0 bits)
- SilkBase 1999-2023 -