SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000810-TA|BGIBMGA000810-PA|undefined
         (65 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07)                   25   6.5  

>SB_34423| Best HMM Match : 7tm_2 (HMM E-Value=6e-07)
          Length = 656

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 14/55 (25%), Positives = 28/55 (50%)

Query: 2   SQEATLGSWALVTHDTLLAITQTYLSLINPVRASSQDVSCSLLKTQTDRFSKIYI 56
           ++ ATL  +A+     L+     Y+  +N ++A++Q    +   +QT R   IY+
Sbjct: 232 NRNATLYVFAIPIALALVVNAIFYILTVNAIKAATQQARMAAENSQTRRHFGIYV 286


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.320    0.129    0.362 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,838,519
Number of Sequences: 59808
Number of extensions: 46110
Number of successful extensions: 87
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 86
Number of HSP's gapped (non-prelim): 1
length of query: 65
length of database: 16,821,457
effective HSP length: 44
effective length of query: 21
effective length of database: 14,189,905
effective search space: 297988005
effective search space used: 297988005
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -