BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000806-TA|BGIBMGA000806-PA|IPR001365|Adenosine/AMP deaminase, IPR006329|AMP deaminase (753 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 24 4.4 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 24 4.4 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.8 bits (49), Expect = 4.4 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Query: 367 IGESRLREVFLKTDNYMNGKYFARIIKEVASDLEESKYQNAELRL--SVYGKSPGEWAKL 424 + E + + L+ D ++ ++EV SDL SK QN + + + G S GE +L Sbjct: 169 VKEHLIFQALLRMDRDISYSQRMARVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRL 228 Query: 425 A 425 + Sbjct: 229 S 229 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.8 bits (49), Expect = 4.4 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Query: 367 IGESRLREVFLKTDNYMNGKYFARIIKEVASDLEESKYQNAELRL--SVYGKSPGEWAKL 424 + E + + L+ D ++ ++EV SDL SK QN + + + G S GE +L Sbjct: 169 VKEHLIFQALLRMDRDISYSQRMARVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRL 228 Query: 425 A 425 + Sbjct: 229 S 229 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.136 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,390 Number of Sequences: 317 Number of extensions: 7444 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 2 length of query: 753 length of database: 114,650 effective HSP length: 62 effective length of query: 691 effective length of database: 94,996 effective search space: 65642236 effective search space used: 65642236 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -