BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000803-TA|BGIBMGA000803-PA|IPR012336|Thioredoxin-like fold, IPR001200|Phosducin (213 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 23 5.2 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 9.1 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 23.4 bits (48), Expect = 5.2 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 115 NQHLRELAVKFPYTKFLKAIAQTCIPNFPERNLPSLFVYFEG-EMKQQ 161 N+ L EL +F + K+L + I N N + ++F+ MKQ+ Sbjct: 62 NKQLTELEKEFHFNKYLTRARRIEIANALHLNETQVKIWFQNRRMKQK 109 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 22.6 bits (46), Expect = 9.1 Identities = 14/50 (28%), Positives = 22/50 (44%) Query: 110 QCALINQHLRELAVKFPYTKFLKAIAQTCIPNFPERNLPSLFVYFEGEMK 159 Q LIN LR Y + K + ++ P N + F+Y+ G +K Sbjct: 210 QAVLINCLLRNYLHYSLYDQADKLVNKSVFPETASNNECARFLYYLGRIK 259 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.135 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,992 Number of Sequences: 2123 Number of extensions: 7575 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 213 length of database: 516,269 effective HSP length: 61 effective length of query: 152 effective length of database: 386,766 effective search space: 58788432 effective search space used: 58788432 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -