BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000798-TA|BGIBMGA000798-PA|IPR004088|KH, type 1, IPR004087|KH (149 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 25 1.3 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 24 1.8 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.6 bits (51), Expect = 1.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 93 NIQISKKGTFAPGTRNRIVTISG 115 N++I+ K TF P + R VT+ G Sbjct: 630 NLEIANKITFHPRIKTRSVTLDG 652 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 24.2 bits (50), Expect = 1.8 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Query: 79 GGRSLVEIQQMSGANIQISKKGTFAPGTRNR 109 G RS++E+QQ + A ++ +G A +RNR Sbjct: 183 GARSVIELQQQAAAAPMMTAQG--AHSSRNR 211 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.130 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,563 Number of Sequences: 2123 Number of extensions: 4060 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 149 length of database: 516,269 effective HSP length: 59 effective length of query: 90 effective length of database: 391,012 effective search space: 35191080 effective search space used: 35191080 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -