BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000798-TA|BGIBMGA000798-PA|IPR004088|KH, type 1,
IPR004087|KH
(149 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.1
>EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein.
Length = 570
Score = 20.6 bits (41), Expect = 7.1
Identities = 11/36 (30%), Positives = 17/36 (47%)
Query: 107 RNRIVTISGSQTAISNAHYLIEQKIQEEELKRTRHN 142
R V++ G + NA K EEE K+T+ +
Sbjct: 512 RGNGVSLKGETVGLLNALPPSSMKETEEEKKKTKQS 547
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.313 0.130 0.355
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,042
Number of Sequences: 429
Number of extensions: 881
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 149
length of database: 140,377
effective HSP length: 53
effective length of query: 96
effective length of database: 117,640
effective search space: 11293440
effective search space used: 11293440
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.0 bits)
S2: 40 (20.2 bits)
- SilkBase 1999-2023 -