BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000798-TA|BGIBMGA000798-PA|IPR004088|KH, type 1, IPR004087|KH (149 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.1 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.6 bits (41), Expect = 7.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 107 RNRIVTISGSQTAISNAHYLIEQKIQEEELKRTRHN 142 R V++ G + NA K EEE K+T+ + Sbjct: 512 RGNGVSLKGETVGLLNALPPSSMKETEEEKKKTKQS 547 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.130 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,042 Number of Sequences: 429 Number of extensions: 881 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 149 length of database: 140,377 effective HSP length: 53 effective length of query: 96 effective length of database: 117,640 effective search space: 11293440 effective search space used: 11293440 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -