BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000797-TA|BGIBMGA000797-PA|undefined (166 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 1.7 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 3.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 4.0 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 20 9.2 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 1.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 24 TPPSAPITQHTLDHIKGAL 42 TPP AP+ Q+ L I G + Sbjct: 421 TPPEAPLFQNVLPPIGGMM 439 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 3.0 Identities = 12/33 (36%), Positives = 15/33 (45%) Query: 128 MPARAVLPLAYSGTSRLDFRILSHKLIRNRFYV 160 +P L LAY+ S LDF I F+V Sbjct: 163 LPELEDLDLAYNSISSLDFNIFDQVGSLGMFHV 195 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 88 PLPAQDPPAVFGPLAQVSLGLPLIGLNI 115 PLP PP + P A LI +N+ Sbjct: 184 PLPPIFPPTMINPSAICESAAQLIFMNV 211 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 20.2 bits (40), Expect = 9.2 Identities = 10/27 (37%), Positives = 12/27 (44%) Query: 22 PGTPPSAPITQHTLDHIKGALRQAGYS 48 PG P+ Q L H + L GYS Sbjct: 104 PGQSPAEKYDQQHLYHPQVLLSPGGYS 130 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.141 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,209 Number of Sequences: 317 Number of extensions: 1024 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 166 length of database: 114,650 effective HSP length: 52 effective length of query: 114 effective length of database: 98,166 effective search space: 11190924 effective search space used: 11190924 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -