Silkworm BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000797-TA|BGIBMGA000797-PA|undefined
         (166 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF106580-3|AAC78205.1|  881|Caenorhabditis elegans Temporarily a...    27   6.8  

>AF106580-3|AAC78205.1|  881|Caenorhabditis elegans Temporarily
           assigned gene nameprotein 268 protein.
          Length = 881

 Score = 27.1 bits (57), Expect = 6.8
 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%)

Query: 88  PLPAQDPPAVFGPLAQVSLGL--PLIGLNIDPPRPRDDRNTFMPAR 131
           P P   PP +  P     LGL  P   L    PRP++   +F+P +
Sbjct: 86  PPPPPPPPTLKAPPPPPILGLKTPSKSLKTPTPRPKECPTSFLPKK 131


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.322    0.141    0.434 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,297,757
Number of Sequences: 27539
Number of extensions: 114729
Number of successful extensions: 214
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 214
Number of HSP's gapped (non-prelim): 1
length of query: 166
length of database: 12,573,161
effective HSP length: 76
effective length of query: 90
effective length of database: 10,480,197
effective search space: 943217730
effective search space used: 943217730
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 56 (26.6 bits)