BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000797-TA|BGIBMGA000797-PA|undefined (166 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0859 - 25473784-25473798,25473862-25473923,25474251-254743... 27 7.6 04_04_1325 + 32666302-32667633 27 7.6 >06_03_0859 - 25473784-25473798,25473862-25473923,25474251-25474345, 25475718-25475831,25476490-25476695,25476834-25476959, 25479516-25480178 Length = 426 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 88 PLPAQDPPAVFGPLAQVSLGLPLIGLNIDPPRPRDDRN 125 PLP PA GPL+Q+S L+G + PP P+ ++ Sbjct: 71 PLPLLPSPAS-GPLSQLSHSGLLVGPSPPPPPPQTQQS 107 >04_04_1325 + 32666302-32667633 Length = 443 Score = 27.1 bits (57), Expect = 7.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 88 PLPAQDPPAVFGPLAQVSLGLPLIGLNIDP 117 P + +PPAV Q +P++ L+ DP Sbjct: 126 PCASHEPPAVTPQWMQADTDIPIVALDFDP 155 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.322 0.141 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,274,819 Number of Sequences: 37544 Number of extensions: 159954 Number of successful extensions: 332 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 331 Number of HSP's gapped (non-prelim): 2 length of query: 166 length of database: 14,793,348 effective HSP length: 77 effective length of query: 89 effective length of database: 11,902,460 effective search space: 1059318940 effective search space used: 1059318940 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -