BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000797-TA|BGIBMGA000797-PA|undefined (166 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24902| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 28 3.4 >SB_24902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 116 DPPRPRDDRNTFMPARAVLPLAYSGTSRLD 145 DPP+ R+ R TF R VLP G++ D Sbjct: 6 DPPKYRERRPTFRSTRNVLPPKLEGSTTFD 35 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query: 88 PLPAQDPP--AVFGPLAQVSLGLPLIGLNIDPPRPRDDRNTFMPARAVLP 135 PLP PP + PL + L LPL+ L + PP R + T +P A P Sbjct: 635 PLPPTPPPRQSTPPPLLLIPL-LPLLTLPLPPPTVRHPQATPLPRLATHP 683 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.322 0.141 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,542,222 Number of Sequences: 59808 Number of extensions: 152890 Number of successful extensions: 219 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 218 Number of HSP's gapped (non-prelim): 2 length of query: 166 length of database: 16,821,457 effective HSP length: 77 effective length of query: 89 effective length of database: 12,216,241 effective search space: 1087245449 effective search space used: 1087245449 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -