BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000797-TA|BGIBMGA000797-PA|undefined
(166 letters)
Database: celegans
27,539 sequences; 12,573,161 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily a... 27 6.8
>AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily
assigned gene nameprotein 268 protein.
Length = 881
Score = 27.1 bits (57), Expect = 6.8
Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%)
Query: 88 PLPAQDPPAVFGPLAQVSLGL--PLIGLNIDPPRPRDDRNTFMPAR 131
P P PP + P LGL P L PRP++ +F+P +
Sbjct: 86 PPPPPPPPTLKAPPPPPILGLKTPSKSLKTPTPRPKECPTSFLPKK 131
Database: celegans
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 12,573,161
Number of sequences in database: 27,539
Lambda K H
0.322 0.141 0.434
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,297,757
Number of Sequences: 27539
Number of extensions: 114729
Number of successful extensions: 214
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 214
Number of HSP's gapped (non-prelim): 1
length of query: 166
length of database: 12,573,161
effective HSP length: 76
effective length of query: 90
effective length of database: 10,480,197
effective search space: 943217730
effective search space used: 943217730
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 56 (26.6 bits)
- SilkBase 1999-2023 -