BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000796-TA|BGIBMGA000796-PA|IPR004088|KH, type 1, IPR004087|KH (157 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 24 0.62 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 24.2 bits (50), Expect = 0.62 Identities = 19/106 (17%), Positives = 40/106 (37%) Query: 10 STAGMIIGKGGNYIKQIKEQSGSYVQISQKAKELSLQERCITVVGEKESNKKACLMILQK 69 S G+ + +I + +S +V ++ ++ + T V + ++ + ++ Sbjct: 257 SRNGVRLSSARAFITPFENRSNLHVIVNATVTKVRTLNKRATGVNVLINGRRRIIFARRE 316 Query: 70 VVDDPQSGSCPNVSYADVAGPVANYNPTGSPYAVPTAEVKEVTHAH 115 V+ S + P + GP + G P V V E H H Sbjct: 317 VILSAGSVNTPQLLMLSGIGPKEHLRSLGIPVVVDLPGVGENLHNH 362 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.133 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,025 Number of Sequences: 429 Number of extensions: 1504 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 157 length of database: 140,377 effective HSP length: 53 effective length of query: 104 effective length of database: 117,640 effective search space: 12234560 effective search space used: 12234560 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -