BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000795-TA|BGIBMGA000795-PA|undefined (79 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 19 6.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 19 6.3 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 19 8.3 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 19 8.3 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 19.0 bits (37), Expect = 6.3 Identities = 10/46 (21%), Positives = 24/46 (52%) Query: 28 VEGIMVVLDFIMEKIKEKPELVKPFPEGVDTKMPQDRDKQVIVITF 73 + + V++ F++ K+ L PF V+ +D+++ + IT+ Sbjct: 1232 LNSLYVIVIFLLTLKKDLLHLDWPFDPKVNFTYFEDKNEIGVYITY 1277 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 19.0 bits (37), Expect = 6.3 Identities = 10/46 (21%), Positives = 24/46 (52%) Query: 28 VEGIMVVLDFIMEKIKEKPELVKPFPEGVDTKMPQDRDKQVIVITF 73 + + V++ F++ K+ L PF V+ +D+++ + IT+ Sbjct: 1232 LNSLYVIVIFLLTLKKDLLHLDWPFDPKVNFTYFEDKNEIGVYITY 1277 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 18.6 bits (36), Expect = 8.3 Identities = 5/16 (31%), Positives = 11/16 (68%) Query: 62 QDRDKQVIVITFDMIF 77 +D D V++ TF++ + Sbjct: 308 EDTDTLVVIYTFNLFY 323 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 18.6 bits (36), Expect = 8.3 Identities = 5/16 (31%), Positives = 11/16 (68%) Query: 62 QDRDKQVIVITFDMIF 77 +D D V++ TF++ + Sbjct: 264 EDTDTLVVIYTFNLFY 279 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.324 0.141 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,512 Number of Sequences: 317 Number of extensions: 537 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 79 length of database: 114,650 effective HSP length: 46 effective length of query: 33 effective length of database: 100,068 effective search space: 3302244 effective search space used: 3302244 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.7 bits) S2: 36 (18.6 bits)
- SilkBase 1999-2023 -