BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000794-TA|BGIBMGA000794-PA|undefined (92 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 1.4 AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced prot... 20 4.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 20 4.4 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 1.4 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Query: 9 TCPSPEITDSRKRPLDGDSENGDVKRSHFS---SVQDLVTALPLANGHG 54 T P P++ + + L G E +V+++ S++DLV L G Sbjct: 687 TTPPPQVDEVDDKELSGAEEEKEVEKALLKPLLSLEDLVRFSTLEGSGG 735 >AB264332-1|BAF44087.1| 58|Apis mellifera ecdysone-induced protein 75 protein. Length = 58 Score = 20.2 bits (40), Expect = 4.4 Identities = 8/18 (44%), Positives = 9/18 (50%) Query: 11 PSPEITDSRKRPLDGDSE 28 PS +I PLD D E Sbjct: 18 PSGDILSPSSEPLDNDKE 35 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 20.2 bits (40), Expect = 4.4 Identities = 8/18 (44%), Positives = 9/18 (50%) Query: 11 PSPEITDSRKRPLDGDSE 28 PS +I PLD D E Sbjct: 18 PSGDILSPSSEPLDNDKE 35 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.131 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,603 Number of Sequences: 429 Number of extensions: 838 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 92 length of database: 140,377 effective HSP length: 48 effective length of query: 44 effective length of database: 119,785 effective search space: 5270540 effective search space used: 5270540 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -