BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000793-TA|BGIBMGA000793-PA|IPR005578|Hrf1 (372 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 1.4 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 9.7 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.6 bits (51), Expect = 1.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Query: 354 WLTYHLVASPPGEGAGPAR 372 W TY P G AGPA+ Sbjct: 395 WFTYQETVDPAGCNAGPAK 413 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 9.7 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Query: 277 CGLLYSSCALSYFLVKTLRLQLLSGSQGPEQ-PSYG 311 CG+ AL Y+L T G GP+ P +G Sbjct: 9 CGIAVLFLALYYYLTSTFDFWKSRGVVGPKPVPFFG 44 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.137 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,463 Number of Sequences: 429 Number of extensions: 4791 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 372 length of database: 140,377 effective HSP length: 59 effective length of query: 313 effective length of database: 115,066 effective search space: 36015658 effective search space used: 36015658 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -