BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000790-TA|BGIBMGA000790-PA|IPR002219|Protein kinase C,
phorbol ester/diacylglycerol binding
(172 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
01_06_0535 + 30061862-30063388 27 8.1
>01_06_0535 + 30061862-30063388
Length = 508
Score = 27.1 bits (57), Expect = 8.1
Identities = 13/48 (27%), Positives = 24/48 (50%)
Query: 58 RHDYCSPNVLQLLNSGTDVVDETLVEIVLTANPLICDVGTESLPLMRP 105
R YCS +L+ G + E ++ +L +PL + + LP++ P
Sbjct: 159 RQPYCSYLLLENCMFGRQIEKERIINFLLAPHPLGDEEDIDVLPIIGP 206
Database: rice
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.327 0.142 0.433
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,052,742
Number of Sequences: 37544
Number of extensions: 201879
Number of successful extensions: 439
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 438
Number of HSP's gapped (non-prelim): 1
length of query: 172
length of database: 14,793,348
effective HSP length: 77
effective length of query: 95
effective length of database: 11,902,460
effective search space: 1130733700
effective search space used: 1130733700
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 57 (27.1 bits)
- SilkBase 1999-2023 -