SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000790-TA|BGIBMGA000790-PA|IPR002219|Protein kinase C,
phorbol ester/diacylglycerol binding
         (172 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    25   1.3  

>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
            protein.
          Length = 1154

 Score = 25.0 bits (52), Expect = 1.3
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 82   VEIVLTANPLICDVGTESLPLMRPHTLAVHSYKAPT 117
            VE V+   P   +V +E L  + P TL  H  ++PT
Sbjct: 966  VEHVMFECPRFAEVRSELLDGVLPETLEAHMLQSPT 1001


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.327    0.142    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,034
Number of Sequences: 2123
Number of extensions: 7539
Number of successful extensions: 25
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 24
Number of HSP's gapped (non-prelim): 1
length of query: 172
length of database: 516,269
effective HSP length: 60
effective length of query: 112
effective length of database: 388,889
effective search space: 43555568
effective search space used: 43555568
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 45 (22.2 bits)

- SilkBase 1999-2023 -