BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000790-TA|BGIBMGA000790-PA|IPR002219|Protein kinase C, phorbol ester/diacylglycerol binding (172 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 8.6 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 21 8.6 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 8.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.6 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Query: 93 CDVGTESLPLMRPHTLAVHSYKAPTFCDFCGE 124 C G ++ HT H+ + P CD CG+ Sbjct: 209 CGKGFTCSKQLKVHT-RTHTGEKPYTCDICGK 239 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/17 (41%), Positives = 12/17 (70%) Query: 79 ETLVEIVLTANPLICDV 95 ET++++ + LICDV Sbjct: 372 ETIIDVSRRRSSLICDV 388 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 150 LKRHLFDKKDLLMAC 164 +K+ +FDK D +AC Sbjct: 47 VKKGIFDKNDEKLAC 61 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 93 CDVGTESLPLMRPHTLAVHS 112 C++ +ES+PL T AV + Sbjct: 799 CELTSESMPLQSALTAAVQT 818 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 93 CDVGTESLPLMRPHTLAVHS 112 C++ +ES+PL T AV + Sbjct: 889 CELTSESMPLQSALTAAVQT 908 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.327 0.142 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,055 Number of Sequences: 429 Number of extensions: 1787 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 5 length of query: 172 length of database: 140,377 effective HSP length: 54 effective length of query: 118 effective length of database: 117,211 effective search space: 13830898 effective search space used: 13830898 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -