GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000789-TA|BGIBMGA000789-PA|undefined
         (95 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like pr...    23   0.41 

>DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like
           protein protein.
          Length = 135

 Score = 23.4 bits (48), Expect = 0.41
 Identities = 13/63 (20%), Positives = 24/63 (38%)

Query: 6   SLASPIGHASIICILPKTGLNSYPTLLEVCAAYPDIMIHSELAGCHPVRRRRPSHARCHD 65
           S+ +P G         ++ L      L  C     + + +E      V+ R P+  +C+ 
Sbjct: 70  SVITPTGFLKECYCCRESFLRERTITLTHCYDPDGVRLTAETVNSMDVKLREPAECKCYK 129

Query: 66  CHD 68
           C D
Sbjct: 130 CGD 132


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.326    0.139    0.484 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,527
Number of Sequences: 317
Number of extensions: 925
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 95
length of database: 114,650
effective HSP length: 48
effective length of query: 47
effective length of database: 99,434
effective search space:  4673398
effective search space used:  4673398
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (20.3 bits)
S2: 37 (19.0 bits)