BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000789-TA|BGIBMGA000789-PA|undefined (95 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.06c |gmh3||alpha-1,2-galactosyltransferase Gmh3|Schizo... 25 1.5 SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E... 23 6.0 SPAC3H5.11 |||NAD/NADH kinase |Schizosaccharomyces pombe|chr 1||... 23 6.0 SPBC4F6.12 |||LIM domain|Schizosaccharomyces pombe|chr 2|||Manual 23 7.9 >SPAC22E12.06c |gmh3||alpha-1,2-galactosyltransferase Gmh3|Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/16 (68%), Positives = 14/16 (87%) Query: 14 ASIICILPKTGLNSYP 29 A+II ILP+T +NSYP Sbjct: 279 AAIIGILPQTLINSYP 294 >SPBC9B6.04c |tuf1||mitochondrial translation elongation factor EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 439 Score = 23.4 bits (48), Expect = 6.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Query: 9 SPIGHASIICIL----PKTGLNSYPTLLEVCAAY 38 +PI S +C L P+ GLNS L+E +Y Sbjct: 208 TPIVSGSALCALEGREPEIGLNSITKLMEAVDSY 241 >SPAC3H5.11 |||NAD/NADH kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 393 Score = 23.4 bits (48), Expect = 6.0 Identities = 17/60 (28%), Positives = 21/60 (35%) Query: 1 MNYADSLASPIGHASIICILPKTGLNSYPTLLEVCAAYPDIMIHSELAGCHPVRRRRPSH 60 M Y DS A +CI TG +Y +PDI + C RP H Sbjct: 263 MLYVDSKYLTTVKADGLCISTPTGSTAYSLAAGGSLCHPDISVMIVSPICAHSLSLRPIH 322 >SPBC4F6.12 |||LIM domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 62 RCHDCHDAMIDRVPHINPPW 81 RC C + D+ HIN W Sbjct: 317 RCKHCKTPIEDQAVHINNDW 336 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.326 0.139 0.484 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 466,817 Number of Sequences: 5004 Number of extensions: 16166 Number of successful extensions: 38 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 36 Number of HSP's gapped (non-prelim): 4 length of query: 95 length of database: 2,362,478 effective HSP length: 62 effective length of query: 33 effective length of database: 2,052,230 effective search space: 67723590 effective search space used: 67723590 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -