BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000789-TA|BGIBMGA000789-PA|undefined (95 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 1.5 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 1.5 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.8 bits (44), Expect = 1.5 Identities = 15/63 (23%), Positives = 24/63 (38%) Query: 6 SLASPIGHASIICILPKTGLNSYPTLLEVCAAYPDIMIHSELAGCHPVRRRRPSHARCHD 65 S+AS G + ++ L L C I + +E G ++ R P +C Sbjct: 80 SVASTTGFSKECYCCRESYLKERHITLHHCYDADGIKLMNEENGVMEIKIREPVECKCIK 139 Query: 66 CHD 68 C D Sbjct: 140 CGD 142 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.8 bits (44), Expect = 1.5 Identities = 15/63 (23%), Positives = 24/63 (38%) Query: 6 SLASPIGHASIICILPKTGLNSYPTLLEVCAAYPDIMIHSELAGCHPVRRRRPSHARCHD 65 S+AS G + ++ L L C I + +E G ++ R P +C Sbjct: 80 SVASTTGFSKECYCCRESYLKERHITLHHCYDADGIKLMNEENGVMEIKIREPVECKCIK 139 Query: 66 CHD 68 C D Sbjct: 140 CGD 142 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.326 0.139 0.484 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,211 Number of Sequences: 429 Number of extensions: 992 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 95 length of database: 140,377 effective HSP length: 49 effective length of query: 46 effective length of database: 119,356 effective search space: 5490376 effective search space used: 5490376 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.7 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -