BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000788-TA|BGIBMGA000788-PA|IPR007274|Ctr copper transporter (213 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20650.1 68418.m02453 copper transporter family protein simil... 37 0.009 At5g59040.1 68418.m07397 copper transporter family protein simil... 32 0.33 At3g46900.1 68416.m05090 copper transporter, putative similar to... 29 1.8 At2g26975.1 68415.m03236 copper transporter, putative similar to... 28 5.5 >At5g20650.1 68418.m02453 copper transporter family protein similar to SP|Q39065 Copper transporter 1 (COPT1) {Arabidopsis thaliana}; contains Pfam profile PF04145: Ctr copper transporter family Length = 146 Score = 37.1 bits (82), Expect = 0.009 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 6/113 (5%) Query: 68 MVFHSCVCTEILFQGWKTTNALELFGSAVAIFLAGVLYEGLKYYREALHTRASSASDSRV 127 M F+ + ILF WKT + L + +A F+ Y+ L+ R + ++ S+S Sbjct: 4 MTFYWGIKATILFDFWKTDSWLSYILTLIACFVFSAFYQYLENRR--IQFKSLSSSRRAP 61 Query: 128 NITKSECGTNSPCAGTAVVKYSMLSGGHIIQTCLHFIQSTASYMLMLIFMTYN 180 +S G ++P + K S L + + Y+LML M++N Sbjct: 62 PPPRSSSGVSAP----LIPKSGTRSAAKAASVLLFGVNAAIGYLLMLAAMSFN 110 >At5g59040.1 68418.m07397 copper transporter family protein similar to SP|Q39065 Copper transporter 1 (COPT1) {Arabidopsis thaliana}; contains Pfam profile PF04145: Ctr copper transporter family Length = 151 Score = 31.9 bits (69), Expect = 0.33 Identities = 13/61 (21%), Positives = 28/61 (45%) Query: 153 GGHIIQTCLHFIQSTASYMLMLIFMTYNVWLCXXXXXXXXXXYFFFGWKKNTVVDMTEHC 212 GG ++QT ++ +++ SY++ML M++N + + FG + H Sbjct: 86 GGGLLQTAVYTVRAALSYLVMLAVMSFNGGVFVAAMAGFGLGFMIFGSRAFRATSSNSHT 145 Query: 213 Q 213 + Sbjct: 146 E 146 >At3g46900.1 68416.m05090 copper transporter, putative similar to SP|Q39065 Copper transporter 1 (COPT1) {Arabidopsis thaliana}; contains Pfam profile PF04145: Ctr copper transporter family Length = 158 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 55 SDDPCAGHDHSHAMVFHSCVC----TEILFQGWKTTNALELFGSAVAIFLAGVLYEGLKY 110 S + H H M+ H TE+LF GW T++ + IFL V+ E L + Sbjct: 15 SSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAH 74 Score = 27.9 bits (59), Expect = 5.5 Identities = 11/44 (25%), Positives = 23/44 (52%) Query: 156 IIQTCLHFIQSTASYMLMLIFMTYNVWLCXXXXXXXXXXYFFFG 199 + QT ++ +++ SY++ML M++N + +F FG Sbjct: 90 LAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFG 133 >At2g26975.1 68415.m03236 copper transporter, putative similar to SP|Q39065 Copper transporter 1 (COPT1) {Arabidopsis thaliana}; contains Pfam profile PF04145: Ctr copper transporter family Length = 145 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Query: 54 NSDDPCAGHDHSHAMVFHSCVC----TEILFQGWKTTNALELFGSAVAIFLAGVLYEGLK 109 +S H +S+ ++ H TEILF GW T+ + +FL V+ E L Sbjct: 9 SSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLLAVIVEWLA 68 Query: 110 Y 110 + Sbjct: 69 H 69 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.324 0.134 0.432 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,260,586 Number of Sequences: 28952 Number of extensions: 130656 Number of successful extensions: 322 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 317 Number of HSP's gapped (non-prelim): 6 length of query: 213 length of database: 12,070,560 effective HSP length: 78 effective length of query: 135 effective length of database: 9,812,304 effective search space: 1324661040 effective search space used: 1324661040 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -