Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000787-TA|BGIBMGA000787-PA|IPR001523|Paired box protein,
N-terminal, IPR009057|Homeodomain-like
         (199 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g29940.1 68414.m03658 DNA-directed RNA polymerase family prot...    27   8.5  

>At1g29940.1 68414.m03658 DNA-directed RNA polymerase family protein
           similar to SP|P22138 DNA-directed RNA polymerase I 135
           kDa polypeptide (EC 2.7.7.6) (RNA polymerase I subunit
           2) {Saccharomyces cerevisiae}; contains Pfam profiles
           PF04563; RNA polymerase beta subunit, PF04560: RNA
           polymerase Rpb2 domain 7, PF04561: RNA polymerase Rpb2
           domain 2, PF04565: RNA polymerase Rpb2 domain 3,
           PF00562: RNA polymerase Rpb2 domain 6
          Length = 1114

 Score = 27.1 bits (57), Expect = 8.5
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 75  ILPGAIGGSKPRVTTPKVVSYIKQLKAKDPGI 106
           +L G + G+       KVVSYI++LK + P +
Sbjct: 512 LLDGQVVGTLSSNLVTKVVSYIRRLKVEAPSV 543


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.322    0.142    0.444 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,904,275
Number of Sequences: 28952
Number of extensions: 140787
Number of successful extensions: 303
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 302
Number of HSP's gapped (non-prelim): 1
length of query: 199
length of database: 12,070,560
effective HSP length: 78
effective length of query: 121
effective length of database: 9,812,304
effective search space: 1187288784
effective search space used: 1187288784
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 57 (27.1 bits)