BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000785-TA|BGIBMGA000785-PA|undefined (177 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 28 0.045 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 6.8 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 28.3 bits (60), Expect = 0.045 Identities = 14/70 (20%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Query: 6 LRHFQDKAHIYKFRTITFGPSVYRAIS-SARWKIFPSSLRLPKLRIKNSGYHKPRILADK 64 L H +Y+ +T+ + ++ I+ ++++P +++ + I++ YHK ++ Sbjct: 89 LNHKFSSVTLYRNKTVKYSARMHAIIACQMEFQLYPMDIQICPIYIESFSYHKQKLRLRW 148 Query: 65 ST-SLTVVPQ 73 T ++TV P+ Sbjct: 149 GTGAVTVNPE 158 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 6.8 Identities = 12/40 (30%), Positives = 19/40 (47%) Query: 46 PKLRIKNSGYHKPRILADKSTSLTVVPQQASIAASTGPSQ 85 P + +S PRI + S+S + P AA+ PS+ Sbjct: 503 PVVETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPSK 542 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.129 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,157 Number of Sequences: 429 Number of extensions: 1728 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 177 length of database: 140,377 effective HSP length: 54 effective length of query: 123 effective length of database: 117,211 effective search space: 14416953 effective search space used: 14416953 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -