BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000784-TA|BGIBMGA000784-PA|undefined (194 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79752-4|CAB02083.1| 1188|Caenorhabditis elegans Hypothetical pr... 28 5.0 Z77661-4|CAB01183.1| 264|Caenorhabditis elegans Hypothetical pr... 27 8.7 >Z79752-4|CAB02083.1| 1188|Caenorhabditis elegans Hypothetical protein D2005.4 protein. Length = 1188 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 1 MQATQSDLTSVTAAPCSGDVQIIQFPIHLKQPDNVRLRKK 40 ++ ++ + S TA CS V I P+ + PDNV++ +K Sbjct: 934 VKTSKDHMDSETAGNCSDSV-INDEPVEAEDPDNVKVERK 972 >Z77661-4|CAB01183.1| 264|Caenorhabditis elegans Hypothetical protein F40G12.5 protein. Length = 264 Score = 27.1 bits (57), Expect = 8.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 162 ACCSTYVQLERLECVAH 178 AC + Y QLE +EC AH Sbjct: 110 ACTAPYFQLEEIECNAH 126 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.321 0.132 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,180,058 Number of Sequences: 27539 Number of extensions: 77390 Number of successful extensions: 147 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 146 Number of HSP's gapped (non-prelim): 2 length of query: 194 length of database: 12,573,161 effective HSP length: 78 effective length of query: 116 effective length of database: 10,425,119 effective search space: 1209313804 effective search space used: 1209313804 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -