SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000782-TA|BGIBMGA000782-PA|undefined
         (270 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    25   0.46 

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 25.4 bits (53), Expect = 0.46
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 90   IAKGKYSRHVTVGAARS--HCIATYSEGHTRHTRSDPLAPCTALG 132
            I +G+ S+ VTV  + S    IA++ +  T   + D   PC A+G
Sbjct: 1288 IGEGQPSKKVTVSPSASVPAKIASFDDTFTTTYKEDVTLPCLAVG 1332


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.130    0.396 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 51,821
Number of Sequences: 317
Number of extensions: 1724
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 270
length of database: 114,650
effective HSP length: 56
effective length of query: 214
effective length of database: 96,898
effective search space: 20736172
effective search space used: 20736172
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 42 (21.0 bits)

- SilkBase 1999-2023 -