Silkworm BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000782-TA|BGIBMGA000782-PA|undefined
         (270 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014296-515|AAF47691.2| 2252|Drosophila melanogaster CG2083-PA ...    31   2.2  

>AE014296-515|AAF47691.2| 2252|Drosophila melanogaster CG2083-PA
           protein.
          Length = 2252

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 14/53 (26%), Positives = 23/53 (43%)

Query: 54  PSKLIDIICTVLCTLYTVHRLDSIGIITSHTRGYDHIAKGKYSRHVTVGAARS 106
           P++++  IC  LC  Y  ++++  G  T H R      K     +    AA S
Sbjct: 58  PARIVGFICMALCDTYYAYQINPYGHYTHHWRKQSRARKNSTKANKLNAAAAS 110


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.322    0.130    0.396 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,995,401
Number of Sequences: 52641
Number of extensions: 364585
Number of successful extensions: 873
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 872
Number of HSP's gapped (non-prelim): 1
length of query: 270
length of database: 24,830,863
effective HSP length: 84
effective length of query: 186
effective length of database: 20,409,019
effective search space: 3796077534
effective search space used: 3796077534
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 61 (28.7 bits)