SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000782-TA|BGIBMGA000782-PA|undefined
         (270 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0429 + 3767486-3768022,3768247-3768523,3769132-3769364,377...    28   6.9  

>08_01_0429 +
           3767486-3768022,3768247-3768523,3769132-3769364,
           3773221-3773625,3773717-3773755
          Length = 496

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 119 HTRSDPLAPCTALGDQTFHIVLIRHRAVIESFSSINHPTFNNALLTESVQVYVSVSN 175
           H R  PL        +T HIVL+R  +  E+   +  P  N  LL  SV  ++S S+
Sbjct: 244 HGRLTPLLIDLPRSRETLHIVLVRPNS--EADDQLLFPNLNALLLLASVTSHISGSS 298


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.322    0.130    0.396 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,674,574
Number of Sequences: 37544
Number of extensions: 221831
Number of successful extensions: 444
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 444
Number of HSP's gapped (non-prelim): 1
length of query: 270
length of database: 14,793,348
effective HSP length: 81
effective length of query: 189
effective length of database: 11,752,284
effective search space: 2221181676
effective search space used: 2221181676
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 59 (27.9 bits)

- SilkBase 1999-2023 -