GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000782-TA|BGIBMGA000782-PA|undefined
         (270 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-5|CAJ14146.1|  615|Anopheles gambiae predicted protein ...    26   1.3  

>CR954256-5|CAJ14146.1|  615|Anopheles gambiae predicted protein
           protein.
          Length = 615

 Score = 25.8 bits (54), Expect = 1.3
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 156 PTFNNALLTESVQVYVSVSNLIANVSVRSRASLRGQDE 193
           P  +  + T + Q+ V +   +ANVS+  + S  G+DE
Sbjct: 149 PKPDRRITTTTQQIVVKLPETVANVSLEHQQSGAGRDE 186


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.322    0.130    0.396 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,344
Number of Sequences: 2123
Number of extensions: 7369
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 270
length of database: 516,269
effective HSP length: 63
effective length of query: 207
effective length of database: 382,520
effective search space: 79181640
effective search space used: 79181640
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 47 (23.0 bits)