BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000782-TA|BGIBMGA000782-PA|undefined (270 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-515|AAF47691.2| 2252|Drosophila melanogaster CG2083-PA ... 31 2.2 >AE014296-515|AAF47691.2| 2252|Drosophila melanogaster CG2083-PA protein. Length = 2252 Score = 30.7 bits (66), Expect = 2.2 Identities = 14/53 (26%), Positives = 23/53 (43%) Query: 54 PSKLIDIICTVLCTLYTVHRLDSIGIITSHTRGYDHIAKGKYSRHVTVGAARS 106 P++++ IC LC Y ++++ G T H R K + AA S Sbjct: 58 PARIVGFICMALCDTYYAYQINPYGHYTHHWRKQSRARKNSTKANKLNAAAAS 110 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.322 0.130 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,995,401 Number of Sequences: 52641 Number of extensions: 364585 Number of successful extensions: 873 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 872 Number of HSP's gapped (non-prelim): 1 length of query: 270 length of database: 24,830,863 effective HSP length: 84 effective length of query: 186 effective length of database: 20,409,019 effective search space: 3796077534 effective search space used: 3796077534 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -