BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000781-TA|BGIBMGA000781-PA|undefined (152 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1ZJ97 Cluster: Tetratricopeptide repeat domain protein... 32 4.7 >UniRef50_A1ZJ97 Cluster: Tetratricopeptide repeat domain protein; n=1; Microscilla marina ATCC 23134|Rep: Tetratricopeptide repeat domain protein - Microscilla marina ATCC 23134 Length = 511 Score = 32.3 bits (70), Expect = 4.7 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 11/85 (12%) Query: 34 ARVDYKLYKVRRAAYA-----DTATEHWFQAFQGYAPMFYDIAIQLFCSAIDCGKNPSQV 88 A+ D +Y R+AA A + A H AF G +Y +AIQ + A D K P Sbjct: 49 AQPDSAIYYARQAASATQKPQEQANAHNLLAFYGLNQGYYGLAIQHYQQAYDLYKQP--- 105 Query: 89 KLLQKKTISSNLHKTCIQNEVHVQA 113 +QK T+ N+ C +N + QA Sbjct: 106 --IQKATMLKNM-AFCHKNTGNYQA 127 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.327 0.136 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,495,551 Number of Sequences: 1657284 Number of extensions: 4626417 Number of successful extensions: 10282 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10282 Number of HSP's gapped (non-prelim): 1 length of query: 152 length of database: 575,637,011 effective HSP length: 94 effective length of query: 58 effective length of database: 419,852,315 effective search space: 24351434270 effective search space used: 24351434270 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 68 (31.5 bits)
- SilkBase 1999-2023 -