GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000781-TA|BGIBMGA000781-PA|undefined
         (152 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory recept...    21   3.5  

>AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory receptor
           candidate 43 protein.
          Length = 353

 Score = 21.4 bits (43), Expect = 3.5
 Identities = 9/30 (30%), Positives = 12/30 (40%)

Query: 50  DTATEHWFQAFQGYAPMFYDIAIQLFCSAI 79
           D    H  + FQ Y   FY + + L    I
Sbjct: 145 DFLCRHTVEYFQNYIHFFYQLLLYLITDMI 174


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.327    0.136    0.433 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,383
Number of Sequences: 317
Number of extensions: 1178
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 152
length of database: 114,650
effective HSP length: 52
effective length of query: 100
effective length of database: 98,166
effective search space:  9816600
effective search space used:  9816600
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 40 (20.2 bits)