BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000781-TA|BGIBMGA000781-PA|undefined (152 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY122084-1|AAM52596.1| 1420|Drosophila melanogaster GH01829p pro... 29 3.6 AY118302-1|AAM48331.1| 798|Drosophila melanogaster GH08432p pro... 29 3.6 AJ973634-5|CAJ00630.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973634-4|CAJ00629.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973634-3|CAJ00628.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973634-2|CAJ00627.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973634-1|CAJ00626.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973633-5|CAJ00625.1| 1386|Drosophila melanogaster thiolester c... 29 3.6 AJ973633-4|CAJ00624.1| 1366|Drosophila melanogaster thiolester c... 29 3.6 AJ973633-3|CAJ00623.1| 1375|Drosophila melanogaster thiolester c... 29 3.6 AJ973633-2|CAJ00622.1| 1377|Drosophila melanogaster thiolester c... 29 3.6 AJ973633-1|CAJ00621.1| 1398|Drosophila melanogaster thiolester c... 29 3.6 AJ973632-5|CAJ00620.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973632-4|CAJ00619.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973632-3|CAJ00618.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973632-2|CAJ00617.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973632-1|CAJ00616.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973631-5|CAJ00615.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973631-4|CAJ00614.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973631-3|CAJ00613.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973631-2|CAJ00612.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973631-1|CAJ00611.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973630-5|CAJ00610.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973630-4|CAJ00609.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973630-3|CAJ00608.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973630-2|CAJ00607.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973630-1|CAJ00606.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973629-5|CAJ00605.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973629-4|CAJ00604.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973629-3|CAJ00603.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973629-2|CAJ00602.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973629-1|CAJ00601.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973628-5|CAJ00600.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973628-4|CAJ00599.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973628-3|CAJ00598.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973628-2|CAJ00597.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973628-1|CAJ00596.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973627-5|CAJ00595.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973627-4|CAJ00594.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973627-3|CAJ00593.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973627-2|CAJ00592.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973627-1|CAJ00591.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973626-5|CAJ00590.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ973626-4|CAJ00589.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973626-3|CAJ00588.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973626-2|CAJ00587.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973626-1|CAJ00586.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973625-5|CAJ00585.1| 1387|Drosophila melanogaster thiolester c... 29 3.6 AJ973625-4|CAJ00584.1| 1367|Drosophila melanogaster thiolester c... 29 3.6 AJ973625-3|CAJ00583.1| 1376|Drosophila melanogaster thiolester c... 29 3.6 AJ973625-2|CAJ00582.1| 1378|Drosophila melanogaster thiolester c... 29 3.6 AJ973625-1|CAJ00581.1| 1399|Drosophila melanogaster thiolester c... 29 3.6 AJ269539-1|CAB87808.1| 1420|Drosophila melanogaster TEP2 protein... 29 3.6 AE014134-1316|AAN10640.1| 1408|Drosophila melanogaster CG7052-PD... 29 3.6 AE014134-1315|AAN10639.1| 1388|Drosophila melanogaster CG7052-PE... 29 3.6 AE014134-1314|AAF52540.2| 1397|Drosophila melanogaster CG7052-PC... 29 3.6 AE014134-1313|AAF52539.2| 1399|Drosophila melanogaster CG7052-PB... 29 3.6 AE014134-1312|AAF52541.2| 1420|Drosophila melanogaster CG7052-PA... 29 3.6 >AY122084-1|AAM52596.1| 1420|Drosophila melanogaster GH01829p protein. Length = 1420 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 729 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 772 >AY118302-1|AAM48331.1| 798|Drosophila melanogaster GH08432p protein. Length = 798 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 107 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 150 >AJ973634-5|CAJ00630.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973634-4|CAJ00629.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973634-3|CAJ00628.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973634-2|CAJ00627.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973634-1|CAJ00626.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973633-5|CAJ00625.1| 1386|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1386 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 695 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 738 >AJ973633-4|CAJ00624.1| 1366|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1366 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 675 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 718 >AJ973633-3|CAJ00623.1| 1375|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1375 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 684 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 727 >AJ973633-2|CAJ00622.1| 1377|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1377 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 686 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 729 >AJ973633-1|CAJ00621.1| 1398|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1398 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 707 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 750 >AJ973632-5|CAJ00620.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973632-4|CAJ00619.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973632-3|CAJ00618.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973632-2|CAJ00617.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973632-1|CAJ00616.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973631-5|CAJ00615.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973631-4|CAJ00614.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973631-3|CAJ00613.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973631-2|CAJ00612.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973631-1|CAJ00611.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973630-5|CAJ00610.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973630-4|CAJ00609.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973630-3|CAJ00608.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973630-2|CAJ00607.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973630-1|CAJ00606.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973629-5|CAJ00605.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973629-4|CAJ00604.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973629-3|CAJ00603.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973629-2|CAJ00602.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973629-1|CAJ00601.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973628-5|CAJ00600.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973628-4|CAJ00599.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973628-3|CAJ00598.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973628-2|CAJ00597.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973628-1|CAJ00596.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973627-5|CAJ00595.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973627-4|CAJ00594.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973627-3|CAJ00593.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973627-2|CAJ00592.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973627-1|CAJ00591.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973626-5|CAJ00590.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ973626-4|CAJ00589.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973626-3|CAJ00588.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973626-2|CAJ00587.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973626-1|CAJ00586.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973625-5|CAJ00585.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 696 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 739 >AJ973625-4|CAJ00584.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 676 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 719 >AJ973625-3|CAJ00583.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 685 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 728 >AJ973625-2|CAJ00582.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 687 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 730 >AJ973625-1|CAJ00581.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AJ269539-1|CAB87808.1| 1420|Drosophila melanogaster TEP2 protein protein. Length = 1420 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 729 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 772 >AE014134-1316|AAN10640.1| 1408|Drosophila melanogaster CG7052-PD, isoform D protein. Length = 1408 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 717 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 760 >AE014134-1315|AAN10639.1| 1388|Drosophila melanogaster CG7052-PE, isoform E protein. Length = 1388 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 697 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 740 >AE014134-1314|AAF52540.2| 1397|Drosophila melanogaster CG7052-PC, isoform C protein. Length = 1397 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 706 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 749 >AE014134-1313|AAF52539.2| 1399|Drosophila melanogaster CG7052-PB, isoform B protein. Length = 1399 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 708 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 751 >AE014134-1312|AAF52541.2| 1420|Drosophila melanogaster CG7052-PA, isoform A protein. Length = 1420 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 77 SAIDCGKNPSQVKLLQKKTISSNLHKTCIQNEVHVQAVTLFEWI 120 S I KNPS++++ Q +S+NL + + EV V +F ++ Sbjct: 729 SGIALTKNPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYL 772 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.327 0.136 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,472,135 Number of Sequences: 52641 Number of extensions: 213177 Number of successful extensions: 661 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 603 Number of HSP's gapped (non-prelim): 58 length of query: 152 length of database: 24,830,863 effective HSP length: 79 effective length of query: 73 effective length of database: 20,672,224 effective search space: 1509072352 effective search space used: 1509072352 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -