GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000780-TA|BGIBMGA000780-PA|undefined
         (53 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q74AU7 Cluster: Glycosyl transferase, group 1 family pr...    31   6.1  

>UniRef50_Q74AU7 Cluster: Glycosyl transferase, group 1 family
           protein; n=1; Geobacter sulfurreducens|Rep: Glycosyl
           transferase, group 1 family protein - Geobacter
           sulfurreducens
          Length = 371

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1   MSNRVTGERITRSTTVVTQEGIYMVYGYSA-DRGLGGLTSL 40
           M N V    +    TV+ +EG+ ++Y +SA D  LGG+ SL
Sbjct: 69  MRNAVHPAALRSFCTVIRREGVDVIYSHSAKDSWLGGIASL 109


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.320    0.133    0.376 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 49,388,060
Number of Sequences: 1657284
Number of extensions: 1191128
Number of successful extensions: 2537
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2537
Number of HSP's gapped (non-prelim): 1
length of query: 53
length of database: 575,637,011
effective HSP length: 33
effective length of query: 20
effective length of database: 520,946,639
effective search space: 10418932780
effective search space used: 10418932780
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 65 (30.3 bits)