BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000780-TA|BGIBMGA000780-PA|undefined (53 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces ... 23 3.7 SPAPB2B4.04c ||pmc1, pmc1|P-type ATPase, calcium transporting Pm... 23 6.4 >SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 301 Score = 23.4 bits (48), Expect = 3.7 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 4 RVTGERITRSTTVVTQEGIYMVYGYSADRGL-GGLTSLFQAGVR 46 RV+ E + T +EG ++ S+D+GL GG+ S +R Sbjct: 77 RVSDEVFKEAGTKAPEEGKTLMVACSSDKGLCGGIHSSISRLIR 120 >SPAPB2B4.04c ||pmc1, pmc1|P-type ATPase, calcium transporting Pmc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1292 Score = 22.6 bits (46), Expect = 6.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 5 VTGERITRSTTVVTQEGIYMVYGYSAD 31 VTG+ I + + +Q GIY G S + Sbjct: 806 VTGDNIVTAKAIASQCGIYTEDGISME 832 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,772 Number of Sequences: 5004 Number of extensions: 4125 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 53 length of database: 2,362,478 effective HSP length: 34 effective length of query: 19 effective length of database: 2,192,342 effective search space: 41654498 effective search space used: 41654498 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -