BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000780-TA|BGIBMGA000780-PA|undefined (53 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 >SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1320 Score = 25.0 bits (52), Expect = 8.6 Identities = 15/43 (34%), Positives = 20/43 (46%) Query: 10 ITRSTTVVTQEGIYMVYGYSADRGLGGLTSLFQAGVRTFYKAH 52 I RS+ +V Q+G+Y A G L S+ A YK H Sbjct: 356 IERSSILVLQQGVYSPLLVEARDVYGNLRSISNAEDLLKYKVH 398 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,434,883 Number of Sequences: 59808 Number of extensions: 32780 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 40 Number of HSP's gapped (non-prelim): 1 length of query: 53 length of database: 16,821,457 effective HSP length: 33 effective length of query: 20 effective length of database: 14,847,793 effective search space: 296955860 effective search space used: 296955860 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -