BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000769-TA|BGIBMGA000769-PA|IPR011701|Major facilitator superfamily MFS_1, IPR007114|Major facilitator superfamily, IPR005829|Sugar transporter superfamily (479 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 27 0.84 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 25 3.4 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 27.5 bits (58), Expect = 0.84 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 7/65 (10%) Query: 232 DPFAALRKVGAERTVLMLCVAVFLS-YLPEAGQYSCIFVYLKLVMGFGVVQVAIFIAIVG 290 D F +R A T++ +C + S Y+ GQ C+ LKLV +G +A+ +AI Sbjct: 454 DQFPRVRNWQAA-TIIAICGVLLGSIYVTPGGQ--CV---LKLVDYYGASSIALVLAIAE 507 Query: 291 VLSIG 295 +++IG Sbjct: 508 LIAIG 512 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 25.4 bits (53), Expect = 3.4 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Query: 230 QADPFAALRKVGAERTVLMLCVAVFLSYLPEAGQYSCIFVYLK--LVMGFG 278 + DPF ALR RT +LC A+ LS C+ + K +VM +G Sbjct: 23 RGDPFVALRTSTTNRT--LLCWAIKLSPTAYVTDAECVRSHRKHQIVMIYG 71 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.328 0.141 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,840 Number of Sequences: 2123 Number of extensions: 18249 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 110 Number of HSP's gapped (non-prelim): 2 length of query: 479 length of database: 516,269 effective HSP length: 67 effective length of query: 412 effective length of database: 374,028 effective search space: 154099536 effective search space used: 154099536 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -