BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000767-TA|BGIBMGA000767-PA|IPR003191|Guanylate-binding protein (564 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 7.5 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 22 9.9 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.6 bits (46), Expect = 7.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 496 IRYSGEMREFGVTIDDTATVMW 517 + Y+GE +F VT D V W Sbjct: 322 VTYAGERFDFIVTADQPQDVYW 343 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 22.2 bits (45), Expect = 9.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Query: 191 EDGGRTPFQRLQFLVRDWSFPYEAPYGADG 220 +DG RT + L RDW EA Y G Sbjct: 81 QDGSRTIIRYLIKNKRDWWNELEAKYDPTG 110 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.136 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,056 Number of Sequences: 317 Number of extensions: 4398 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 564 length of database: 114,650 effective HSP length: 60 effective length of query: 504 effective length of database: 95,630 effective search space: 48197520 effective search space used: 48197520 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -