BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000766-TA|BGIBMGA000766-PA|undefined (1690 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 26 2.5 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 25 4.4 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 25.8 bits (54), Expect = 2.5 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 350 PTAPRDHEVLAQLVRMRLKTKQLQLAYQACLREMVSES 387 P P++ E + Q++ + + Q+QL C M+ S Sbjct: 188 PITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRS 225 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 25.0 bits (52), Expect = 4.4 Identities = 13/41 (31%), Positives = 20/41 (48%) Query: 755 RLLSQLTTLEPLGAPRKPPQAIIESLQALNAQLRLGKLLCR 795 R L + + G P+ PQ+++ S L+ LR G L R Sbjct: 237 RHLERKAWVASFGRPKMTPQSLLPSQTGLSPYLRFGCLSTR 277 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 339,205 Number of Sequences: 317 Number of extensions: 13053 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 41 Number of HSP's gapped (non-prelim): 2 length of query: 1690 length of database: 114,650 effective HSP length: 66 effective length of query: 1624 effective length of database: 93,728 effective search space: 152214272 effective search space used: 152214272 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -